PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21001.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 256aa    MW: 27923.2 Da    PI: 4.9146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21001.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181156147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W+++Ed  l+++v+++G+++W++I++ ++ gR++k+c++rw + 
  mrna21001.1-v1.0-hybrid 11 KGSWSPQEDATLIKLVAEHGPRNWSLISSGIP-GRSGKSCRLRWCNQ 56
                             799*****************************.***********985 PP

2Myb_DNA-binding543.8e-1764107247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +++T+ Ed  +v a++++G++ W+tIar ++ gRt++ +k++w++ 
  mrna21001.1-v1.0-hybrid  64 KPFTPAEDAAIVTAHALHGNK-WATIARLLP-GRTDNAIKNHWNST 107
                              68*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.347661IPR017930Myb domain
SuperFamilySSF466891.24E-298104IPR009057Homeodomain-like
SMARTSM007173.5E-161059IPR001005SANT/Myb domain
PfamPF002491.4E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-241264IPR009057Homeodomain-like
CDDcd001672.11E-151355No hitNo description
SMARTSM007171.2E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129420.48662112IPR017930Myb domain
PfamPF002492.6E-1464107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2365111IPR009057Homeodomain-like
CDDcd001674.32E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MSAGAGDNRV KGSWSPQEDA TLIKLVAEHG PRNWSLISSG IPGRSGKSCR LRWCNQLSPD  60
VQHKPFTPAE DAAIVTAHAL HGNKWATIAR LLPGRTDNAI KNHWNSTLRR RRLAESSSTS  120
SESMKRLIVG GGGAEPEMKR QCLRGAEEES GFKAVTAGVE GVLTSLTLSP PGEKVGDDVV  180
LKSEEEEVEE EEENEEHQEE AVDDGEKCTV EMEETCLMSM MQRMIAQEVR NYIESLRAEN  240
GLAFGLQSAV HDPKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-37101113104MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-371011157158MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-371011157158MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-37101113104C-Myb DNA-Binding Domain
1msf_C2e-37101113104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470630.11e-134PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW18e-53MYB44_ARATH; Transcription factor MYB44
TrEMBLM5XTD91e-106M5XTD9_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01360.t012e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-50myb domain protein r1